PDB entry 1nd0

View 1nd0 on RCSB PDB site
Description: cationic cyclization antibody 4c6 complex with transition state analog
Deposited on 2002-12-05, released 2003-05-13
The last revision prior to the SCOP 1.69 freeze date was dated 2003-05-13, with a file datestamp of 2003-05-13.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.242
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nd0A (A:)
    dvvmtqspktisvtigqpasisckssqrllnsngktflnwllqrpgqspkrliylgtkld
    sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nd0B (B:)
    rvqlqqsgpglvkpsqslsltctvtgysitsdfawnwirqfpgnklewmgyinysgftsh
    npslksrisitrdtsknqfflqlnsvttedtatyycagllwydggagswgqgtlvtvsaa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nd0C (C:)
    dvvmtqspktisvtigqpasisckssqrllnsngktflnwllqrpgqspkrliylgtkld
    sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nd0D (D:)
    rvqlqqsgpglvkpsqslsltctvtgysitsdfawnwirqfpgnklewmgyinysgftsh
    npslksrisitrdtsknqfflqlnsvttedtatyycagllwydggagswgqgtlvtvsaa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpt
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nd0E (E:)
    dvvmtqspktisvtigqpasisckssqrllnsngktflnwllqrpgqspkrliylgtkld
    sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nd0F (F:)
    rvqlqqsgpglvkpsqslsltctvtgysitsdfawnwirqfpgnklewmgyinysgftsh
    npslksrisitrdtsknqfflqlnsvttedtatyycagllwydggagswgqgtlvtvsaa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpt
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nd0G (G:)
    dvvmtqspktisvtigqpasisckssqrllnsngktflnwllqrpgqspkrliylgtkld
    sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nd0H (H:)
    rvqlqqsgpglvkpsqslsltctvtgysitsdfawnwirqfpgnklewmgyinysgftsh
    npslksrisitrdtsknqfflqlnsvttedtatyycagllwydggagswgqgtlvtvsaa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpt