PDB entry 1ncw

View 1ncw on RCSB PDB site
Description: Cationic Cyclization Antibody 4C6 in Complex with Benzoic Acid
Deposited on 2002-12-05, released 2003-05-13
The last revision prior to the SCOP 1.69 freeze date was dated 2003-05-13, with a file datestamp of 2003-05-13.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.158
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ncwH (H:)
    rvqlqqsgpglvkpsqslsltctvtgysitsdfawnwirqfpgnklewmgyinysgftsh
    npslksrisitrdtsknqfflqlnsvttedtatyycagllwydggagswgqgtlvtvsaa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpt
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ncwL (L:)
    dvvmtqspktisvtigqpasisckssqrllnsngktflnwllqrpgqspkrliylgtkld
    sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec