PDB entry 1ncw

View 1ncw on RCSB PDB site
Description: Cationic Cyclization Antibody 4C6 in Complex with Benzoic Acid
Class: immune system
Keywords: immunoglobulin, catalytic antibody, cationic cyclization reaction, IMMUNE SYSTEM
Deposited on 2002-12-05, released 2003-05-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.158
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin igg2a
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1NCW (0-221)
    Domains in SCOPe 2.07: d1ncwh1, d1ncwh2
  • Chain 'L':
    Compound: immunoglobulin igg2a
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1NCW (0-218)
    Domains in SCOPe 2.07: d1ncwl1, d1ncwl2
  • Heterogens: BEZ, GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ncwH (H:)
    rvqlqqsgpglvkpsqslsltctvtgysitsdfawnwirqfpgnklewmgyinysgftsh
    npslksrisitrdtsknqfflqlnsvttedtatyycagllwydggagswgqgtlvtvsaa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpt
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ncwL (L:)
    dvvmtqspktisvtigqpasisckssqrllnsngktflnwllqrpgqspkrliylgtkld
    sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec