PDB entry 1ncs

View 1ncs on RCSB PDB site
Description: nmr study of swi5 zinc finger domain 1
Class: transcription regulation
Keywords: DNA binding motif, transcription regulation, zinc-finger
Deposited on 1996-02-26, released 1996-06-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transcriptional factor swi5
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: T7
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08153 (0-46)
  Domains in SCOPe 2.03: d1ncsa_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ncsA (A:)
  tlprgsidkyvkempdktfeclfpgctktfkrrynirshiqthledr