PDB entry 1ncl

View 1ncl on RCSB PDB site
Description: thermal stability of hexameric and tetrameric nucleoside, diphosphate kinases
Class: transferase
Keywords: enzyme, transferase, kinase, ATP-binding
Deposited on 1996-03-22, released 1996-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.181
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (0-149)
      • engineered (99)
    Domains in SCOPe 2.07: d1ncla_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nclA (A:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasaggsirgdfgvdvgrniihgsd
    svesanreialwfkpeelltevkpnpnlye