PDB entry 1ncg

View 1ncg on RCSB PDB site
Description: structural basis of cell-cell adhesion by cadherins
Deposited on 1995-03-23, released 1995-07-10
The last revision prior to the SCOP 1.55 freeze date was dated 1995-07-10, with a file datestamp of 1995-07-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.217
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1ncg__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ncg_ (-)
  dwvippinlpensrgpfpqelvrirsgrdknlslrysvtgpgadqpptgifiinpisgql
  svtkpldreliarfhlrahavdingnqvenpidivinvi