PDB entry 1ncg

View 1ncg on RCSB PDB site
Description: structural basis of cell-cell adhesion by cadherins
Class: cell adhesion protein
Keywords: cadherin, cell adhesion protein
Deposited on 1995-03-23, released 1995-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n-cadherin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15116 (2-End)
      • conflict (28)
    Domains in SCOPe 2.08: d1ncga_
  • Heterogens: YB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ncgA (A:)
    gsdwvippinlpensrgpfpqelvrirsgrdknlslrysvtgpgadqpptgifiinpisg
    qlsvtkpldreliarfhlrahavdingnqvenpidivinvidmndnrpef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ncgA (A:)
    dwvippinlpensrgpfpqelvrirsgrdknlslrysvtgpgadqpptgifiinpisgql
    svtkpldreliarfhlrahavdingnqvenpidivinvi