PDB entry 1ncc

View 1ncc on RCSB PDB site
Description: crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface
Deposited on 1992-01-21, released 1994-01-31
The last revision prior to the SCOP 1.69 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.212
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nccH (H:)
    qiqlvqsgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintntgepty
    geefkgrfafsletsastanlqinnlknedtatffcargednfgslsdywgqgttvtvss
    akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nccL (L:)
    divmtqspkfmstsvgdrvtitckasqdvstavvwyqqkpgqspklliywastrhigvpd
    rfagsgsgtdytltissvqaedlalyycqqhysppwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nccN (N:)
    irdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgtti
    rgkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnn
    nasaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfke
    gkilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyics
    pvltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisrasrsgyemlkvp
    naltddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwt
    snsivsmcssteflgqwdwpdgakieyfl