PDB entry 1ncb

View 1ncb on RCSB PDB site
Description: crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface
Class: hydrolase(o-glycosyl)
Keywords: hydrolase(o-glycosyl)
Deposited on 1992-01-21, released 1994-01-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.165
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg2a-kappa nc41 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ncbh1, d1ncbh2
  • Chain 'L':
    Compound: igg2a-kappa nc41 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA72328 (0-213)
      • conflict (19-20)
      • conflict (27)
      • conflict (29)
      • conflict (31)
      • conflict (33)
      • conflict (45)
      • conflict (49)
      • conflict (52)
      • conflict (54-55)
      • conflict (62)
      • conflict (70)
      • conflict (76)
      • conflict (79)
      • conflict (84)
      • conflict (86)
      • conflict (90-93)
    Domains in SCOPe 2.05: d1ncbl1, d1ncbl2
  • Chain 'N':
    Compound: influenza a subtype n9 neuraminidase
    Species: Influenza A virus [TaxId:384509]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03472 (0-388)
      • conflict (249)
    Domains in SCOPe 2.05: d1ncbn_
  • Heterogens: NAG, CA, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ncbH (H:)
    qiqlvqsgpelkkpgetvkisckasgytftnygmnwvkqapgkglewmgwintntgepty
    geefkgrfafsletsastanlqinnlknedkatffcargednfgslsdywgqgttltvss
    akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ncbL (L:)
    divmtqspkfmstsvgdrvtitckasqdvstavvwyqqkpgqspklliywastrhigvpd
    rfagsgsgtdytltissvqaedlalyycqqhysppwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ncbN (N:)
    irdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgtti
    rgkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnn
    nasaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfke
    gkilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyics
    pvltdnprpddptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvp
    naltddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwt
    snsivsmcssteflgqwdwpdgakieyfl