PDB entry 1nca

View 1nca on RCSB PDB site
Description: refined crystal structure of the influenza virus n9 neuraminidase-nc41 fab complex
Deposited on 1992-01-21, released 1994-01-31
The last revision prior to the SCOP 1.69 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.191
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ncaH (H:)
    qiqlvqsgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintntgepty
    geefkgrfafsletsastanlqinnlknedtatffcargednfgslsdywgqgttvtvss
    akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ncaL (L:)
    divmtqspkfmstsvgdrvtitckasqdvstavvwyqqkpgqspklliywastrhigvpd
    rfagsgsgtdytltissvqaedlalyycqqhysppwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ncaN (N:)
    irdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgtti
    rgkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnn
    nasaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfke
    gkilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyics
    pvltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvp
    naltddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwt
    snsivsmcssteflgqwdwpdgakieyfl