PDB entry 1nc7

View 1nc7 on RCSB PDB site
Description: Crystal Structure of Thermotoga maritima 1070
Class: structural genomics, unknown function
Keywords: Structural genomics, Hypothetical protein, Molecular propeller, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2002-12-04, released 2003-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TM1070
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1070
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0F9 (22-135)
      • cloning artifact (21)
      • modified residue (22)
      • modified residue (52)
      • modified residue (82)
      • modified residue (103)
      • modified residue (112)
      • modified residue (127)
      • cloning artifact (136)
    Domains in SCOPe 2.07: d1nc7a1, d1nc7a2, d1nc7a3
  • Chain 'B':
    Compound: hypothetical protein TM1070
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1070
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0F9 (22-135)
      • modified residue (22)
      • modified residue (52)
      • modified residue (82)
      • modified residue (103)
      • modified residue (112)
      • modified residue (127)
      • cloning artifact (136-137)
    Domains in SCOPe 2.07: d1nc7b1, d1nc7b2
  • Chain 'C':
    Compound: hypothetical protein TM1070
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1070
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0F9 (22-135)
      • modified residue (22)
      • modified residue (52)
      • modified residue (82)
      • modified residue (103)
      • modified residue (112)
      • modified residue (127)
      • cloning artifact (136-137)
    Domains in SCOPe 2.07: d1nc7c1, d1nc7c2
  • Chain 'D':
    Compound: hypothetical protein TM1070
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1070
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0F9 (22-135)
      • cloning artifact (21)
      • modified residue (22)
      • modified residue (52)
      • modified residue (82)
      • modified residue (103)
      • modified residue (112)
      • modified residue (127)
      • cloning artifact (136-137)
    Domains in SCOPe 2.07: d1nc7d1, d1nc7d2, d1nc7d3
  • Heterogens: CL, MG, EDO, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nc7A (A:)
    mgsshhhhhhssgrenlyfqghmngarkwffpdgyipngkrgylvsheslcimntgdeta
    kiritflfedskpvvheveispmkslhlrldklgipkckpysimaesnvpvvmqlsrldv
    gknhytlmttigyweegs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nc7A (A:)
    hmngarkwffpdgyipngkrgylvsheslcimntgdetakiritflfedskpvvheveis
    pmkslhlrldklgipkckpysimaesnvpvvmqlsrldvgknhytlmttigyweeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nc7B (B:)
    mgsshhhhhhssgrenlyfqghmngarkwffpdgyipngkrgylvsheslcimntgdeta
    kiritflfedskpvvheveispmkslhlrldklgipkckpysimaesnvpvvmqlsrldv
    gknhytlmttigyweegs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nc7B (B:)
    mngarkwffpdgyipngkrgylvsheslcimntgdetakiritflfedskpvvheveisp
    mkslhlrldklgipkckpysimaesnvpvvmqlsrldvgknhytlmttigyweegs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nc7C (C:)
    mgsshhhhhhssgrenlyfqghmngarkwffpdgyipngkrgylvsheslcimntgdeta
    kiritflfedskpvvheveispmkslhlrldklgipkckpysimaesnvpvvmqlsrldv
    gknhytlmttigyweegs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nc7C (C:)
    mngarkwffpdgyipngkrgylvsheslcimntgdetakiritflfedskpvvheveisp
    mkslhlrldklgipkckpysimaesnvpvvmqlsrldvgknhytlmttigyweegs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nc7D (D:)
    mgsshhhhhhssgrenlyfqghmngarkwffpdgyipngkrgylvsheslcimntgdeta
    kiritflfedskpvvheveispmkslhlrldklgipkckpysimaesnvpvvmqlsrldv
    gknhytlmttigyweegs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nc7D (D:)
    hmngarkwffpdgyipngkrgylvsheslcimntgdetakiritflfedskpvvheveis
    pmkslhlrldklgipkckpysimaesnvpvvmqlsrldvgknhytlmttigyweegs