PDB entry 1nc6

View 1nc6 on RCSB PDB site
Description: Potent, small molecule inhibitors of human mast cell tryptase. Anti-asthmatic action of a dipeptide-based transition state analogue containing benzothiazole ketone
Class: hydrolase
Keywords: protein-inhibitor complex, HYDROLASE
Deposited on 2002-12-04, released 2003-09-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.175
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: trypsinogen
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00760 (0-222)
  Domains in SCOPe 2.02: d1nc6a_
• Heterogens: CA, SO4, ABB, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nc6A (A:)
  ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
  neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
  wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
  vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn