PDB entry 1nc3

View 1nc3 on RCSB PDB site
Description: Crystal structure of E. coli MTA/AdoHcy nucleosidase complexed with formycin A (FMA)
Class: hydrolase
Keywords: mixed alpha/beta dimer, HYDROLASE
Deposited on 2002-12-04, released 2003-03-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MTA/SAH nucleosidase
    Species: Escherichia coli [TaxId:562]
    Gene: MTN OR PFS OR B0159 OR Z0170 OR ECS0163
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24247 (10-241)
      • expression tag (7-9)
    Domains in SCOPe 2.06: d1nc3a1, d1nc3a2
  • Chain 'B':
    Compound: MTA/SAH nucleosidase
    Species: Escherichia coli [TaxId:562]
    Gene: MTN OR PFS OR B0159 OR Z0170 OR ECS0163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nc3b_
  • Heterogens: FMC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nc3A (A:)
    fqgamdpefsmkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgi
    gkvaaalgatlllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeyg
    qlpgcpagfkaddkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaia
    vemeataiahvchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqkla
    hg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nc3A (A:)
    efsmkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaal
    gatlllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpa
    gfkaddkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeata
    iahvchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqklahg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nc3B (B:)
    fqgamdpefsmkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgi
    gkvaaalgatlllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeyg
    qlpgcpagfkaddkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaia
    vemeataiahvchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqkla
    hg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nc3B (B:)
    mkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaalgat
    lllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpagfk
    addkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeataiah
    vchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqkla