PDB entry 1nc3

View 1nc3 on RCSB PDB site
Description: Crystal structure of E. coli MTA/AdoHcy nucleosidase complexed with formycin A (FMA)
Deposited on 2002-12-04, released 2003-03-25
The last revision prior to the SCOP 1.65 freeze date was dated 2003-03-25, with a file datestamp of 2003-03-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1nc3a_
  • Chain 'B':
    Domains in SCOP 1.65: d1nc3b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nc3A (A:)
    fqgamdpefsmkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgi
    gkvaaalgatlllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeyg
    qlpgcpagfkaddkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaia
    vemeataiahvchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqkla
    hg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nc3A (A:)
    efsmkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaal
    gatlllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpa
    gfkaddkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeata
    iahvchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqklahg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nc3B (B:)
    fqgamdpefsmkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgi
    gkvaaalgatlllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeyg
    qlpgcpagfkaddkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaia
    vemeataiahvchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqkla
    hg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nc3B (B:)
    mkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaalgat
    lllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpagfk
    addkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeataiah
    vchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqkla