PDB entry 1nc2

View 1nc2 on RCSB PDB site
Description: Crystal Structure of Monoclonal Antibody 2D12.5 Fab Complexed with Y-DOTA
Class: Immune system
Keywords: ANTIBODY-DOTA COMPLEX, RARE EARTH, DOTA, METAL CHELATE, YTTRIUM, GAMMA TURN, N-LINKED GLYCOSYLATION, Immune system
Deposited on 2002-12-04, released 2003-12-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.209
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: monoclonal antibody 2d12.5, lambda light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1NC2 (0-End)
    Domains in SCOPe 2.01: d1nc2a1, d1nc2a2
  • Chain 'B':
    Compound: monoclonal antibody 2d12.5, igg1 gamma heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1NC2 (0-End)
    Domains in SCOPe 2.01: d1nc2b1, d1nc2b2
  • Chain 'C':
    Compound: monoclonal antibody 2d12.5, lambda light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1NC2 (0-214)
    Domains in SCOPe 2.01: d1nc2c1, d1nc2c2
  • Chain 'D':
    Compound: monoclonal antibody 2d12.5, igg1 gamma heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1NC2 (0-220)
    Domains in SCOPe 2.01: d1nc2d1, d1nc2d2
  • Heterogens: NAG, YT3, CL, DOE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nc2A (A:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggnnnrppgv
    parfsgsligdkaaltiagtqtedeaiyfcalwysnhwvfgggtrltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslspaecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nc2A (A:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggnnnrppgv
    parfsgsligdkaaltiagtqtedeaiyfcalwysnhwvfgggtrltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nc2B (B:)
    evklqesgpglvqpsqslsitctvsgfsltdygvhwvrqspgkglewlgviwsgggtayt
    aafisrlniykdnsknqvffemnslqandtamyycarrgsypynyfdvwgqgttvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nc2B (B:)
    evklqesgpglvqpsqslsitctvsgfsltdygvhwvrqspgkglewlgviwsgggtayt
    aafisrlniykdnsknqvffemnslqandtamyycarrgsypynyfdvwgqgttvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nc2C (C:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggnnnrppgv
    parfsgsligdkaaltiagtqtedeaiyfcalwysnhwvfgggtrltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslspaecs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nc2D (D:)
    qvklqesgpglvqpsqslsitctvsgfsltdygvhwvrqspgkglewlgviwsgggtayt
    aafisrlniykdnsknqvffemnslqandtamyycarrgsypynyfdvwgqgttvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nc2D (D:)
    qvklqesgpglvqpsqslsitctvsgfsltdygvhwvrqspgkglewlgviwsgggtayt
    aafisrlniykdnsknqvffemnslqandtamyycarrgsypynyfdvwgqgttvtvssa
    kttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpsstwpsetvtcnvahpasstkvdkkivprdc