PDB entry 1nc2

View 1nc2 on RCSB PDB site
Description: Crystal Structure of Monoclonal Antibody 2D12.5 Fab Complexed with Y-DOTA
Deposited on 2002-12-04, released 2003-12-16
The last revision prior to the SCOP 1.69 freeze date was dated 2003-12-16, with a file datestamp of 2003-12-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.209
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nc2A (A:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggnnnrppgv
    parfsgsligdkaaltiagtqtedeaiyfcalwysnhwvfgggtrltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslspaecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nc2A (A:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggnnnrppgv
    parfsgsligdkaaltiagtqtedeaiyfcalwysnhwvfgggtrltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nc2B (B:)
    evklqesgpglvqpsqslsitctvsgfsltdygvhwvrqspgkglewlgviwsgggtayt
    aafisrlniykdnsknqvffemnslqandtamyycarrgsypynyfdvwgqgttvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nc2B (B:)
    evklqesgpglvqpsqslsitctvsgfsltdygvhwvrqspgkglewlgviwsgggtayt
    aafisrlniykdnsknqvffemnslqandtamyycarrgsypynyfdvwgqgttvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nc2C (C:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggnnnrppgv
    parfsgsligdkaaltiagtqtedeaiyfcalwysnhwvfgggtrltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslspaecs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nc2D (D:)
    qvklqesgpglvqpsqslsitctvsgfsltdygvhwvrqspgkglewlgviwsgggtayt
    aafisrlniykdnsknqvffemnslqandtamyycarrgsypynyfdvwgqgttvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nc2D (D:)
    qvklqesgpglvqpsqslsitctvsgfsltdygvhwvrqspgkglewlgviwsgggtayt
    aafisrlniykdnsknqvffemnslqandtamyycarrgsypynyfdvwgqgttvtvssa
    kttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpsstwpsetvtcnvahpasstkvdkkivprdc