PDB entry 1nbv

View 1nbv on RCSB PDB site
Description: an autoantibody to single-stranded DNA: comparison of the three-dimensional structures of the unliganded fab and a deoxynucleotide-fab complex
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1993-03-16, released 1994-01-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.246
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg2b-kappa bv04-01 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1nbvh1, d1nbvh2
  • Chain 'L':
    Compound: igg2b-kappa bv04-01 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR S16112 (0-218)
      • conflict (38)
      • conflict (50)
      • conflict (54)
      • conflict (93)
      • conflict (95)
      • conflict (100)
      • conflict (104)
      • conflict (107)
      • conflict (110)
    Domains in SCOPe 2.03: d1nbvl1, d1nbvl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nbvH (H:)
    evqpvetggglvqpkgslklscaasgfsfntnamnwvrqapgkglewvarirsksnnyat
    yyadsvkdrftisrddsqnmlylqmnnlktedtamyycvrdqtgtawfaywgqgtlvtvs
    aakttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqs
    glytmsssvtvpsstwpsqtvtcsvahpassttvdkkle
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nbvL (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec