PDB entry 1nbu

View 1nbu on RCSB PDB site
Description: 7,8-Dihydroneopterin Aldolase Complexed with Product From Mycobacterium Tuberculosis
Deposited on 2002-12-03, released 2004-01-13
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-13, with a file datestamp of 2004-01-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.177
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1nbua_
  • Chain 'B':
    Domains in SCOP 1.67: d1nbub_
  • Chain 'C':
    Domains in SCOP 1.67: d1nbuc_
  • Chain 'D':
    Domains in SCOP 1.67: d1nbud_
  • Chain 'E':
    Domains in SCOP 1.67: d1nbue_
  • Chain 'F':
    Domains in SCOP 1.67: d1nbuf_
  • Chain 'G':
    Domains in SCOP 1.67: d1nbug_
  • Chain 'H':
    Domains in SCOP 1.67: d1nbuh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nbuA (A:)
    madrielrgltvhgrhgvydhervagqrfvidvtvwidlaeaansddladtydyvrlasr
    aaeivagpprklietvgaeiadhvmddqrvhavevavhkpqapipqtfddvavvirrsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nbuA (A:)
    adrielrgltvhgrhgvydhervagqrfvidvtvwidlaeaansddladtydyvrlasra
    aeivagpprklietvgaeiadhvmddqrvhavevavhkpqapipqtfddvavvirrsr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nbuB (B:)
    madrielrgltvhgrhgvyahervagqrfvidvtvwidlaeaansddladtydyvrlasr
    aaeivagpprklietvgaeiadhvmddqrvhavevavhkpqapipqtfddvavvirrsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nbuB (B:)
    adrielrgltvhgrhgvyahervagqrfvidvtvwidlaeaansddladtydyvrlasra
    aeivagpprklietvgaeiadhvmddqrvhavevavhkpqapipqtfddvavvirrsr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nbuC (C:)
    madrielrgltvhgrhgvaahervagqrfvidvtvwidlaeaansddladtydyvrlasr
    aaeivagpprklietvgaeiadhvmddqrvhavevavhkpqapipqtfddvavvirrsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nbuC (C:)
    adrielrgltvhgrhgvaahervagqrfvidvtvwidlaeaansddladtydyvrlasra
    aeivagpprklietvgaeiadhvmddqrvhavevavhkpqapipqtfddvavvirrsr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nbuD (D:)
    madrielrgltvhgrhgvyahervagqrfvidvtvwidlaeaansddladtydyvrlasr
    aaeivagpprklietvgaeiadhvmddqrvhavevavhkpqapipqtfddvavvirrsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nbuD (D:)
    adrielrgltvhgrhgvyahervagqrfvidvtvwidlaeaansddladtydyvrlasra
    aeivagpprklietvgaeiadhvmddqrvhavevavhkpqapipqtfddvavvirrsr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1nbuE (E:)
    madrielrgltvhgrhgvydhervagqrfvidvtvwidlaeaansddladtydyvrlasr
    aaeivagpprklietvgaeiadhvmddqrvhavevavhkpqapipqtfddvavvirrsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nbuE (E:)
    adrielrgltvhgrhgvydhervagqrfvidvtvwidlaeaansddladtydyvrlasra
    aeivagpprklietvgaeiadhvmddqrvhavevavhkpqapipqtfddvavvirrsr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1nbuF (F:)
    madrielrgltvhgrhgvydhervagqrfvidvtvwidlaeaansddladtydyvrlasr
    aaeivagpprklietvgaeiadhvmddqrvhavevavhkpqapipqtfddvavvirrsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nbuF (F:)
    adrielrgltvhgrhgvydhervagqrfvidvtvwidlaeaansddladtydyvrlasra
    aeivagpprklietvgaeiadhvmddqrvhavevavhkpqapipqtfddvavvirrsr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1nbuG (G:)
    madrielrgltvhgrhgvydhervagqrfvidvtvwidlaeaansddladtydyvrlasr
    aaeivagpprklietvgaeiadhvmddqrvhavevavhkpqapipqtfddvavvirrsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nbuG (G:)
    adrielrgltvhgrhgvydhervagqrfvidvtvwidlaeaansddladtydyvrlasra
    aeivagpprklietvgaeiadhvmddqrvhavevavhkpqapipqtfddvavvirrsr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1nbuH (H:)
    madrielrgltvhgrhgvydhervagqrfvidvtvwidlaeaansddladtydyvrlasr
    aaeivagpprklietvgaeiadhvmddqrvhavevavhkpqapipqtfddvavvirrsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nbuH (H:)
    adrielrgltvhgrhgvydhervagqrfvidvtvwidlaeaansddladtydyvrlasra
    aeivagpprklietvgaeiadhvmddqrvhavevavhkpqapipqtfddvavvirrsr