PDB entry 1nbq

View 1nbq on RCSB PDB site
Description: Crystal Structure of Human Junctional Adhesion Molecule Type 1
Class: immune system
Keywords: reovirus receptor, adhesion molecule, tight junction formation, immunoglobulin superfamily, IMMUNE SYSTEM
Deposited on 2002-12-03, released 2003-04-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.22
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Junctional adhesion molecule 1
    Species: Homo sapiens [TaxId:9606]
    Gene: JAM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y624 (2-208)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1nbqa1, d1nbqa2, d1nbqa3
  • Chain 'B':
    Compound: Junctional adhesion molecule 1
    Species: Homo sapiens [TaxId:9606]
    Gene: JAM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y624 (2-208)
      • cloning artifact (1)
    Domains in SCOPe 2.06: d1nbqb1, d1nbqb2, d1nbqb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nbqA (A:)
    amgsvtvhssepevripennpvklscaysgfssprvewkfdqgdttrlvcynnkitasye
    drvtflptgitfksvtredtgtytcmvseeggnsygevkvklivlvppskptvnipssat
    ignravltcseqdgsppseytwfkdgivmptnpkstrafsnssyvlnpttgelvfdplsa
    sdtgeyscearngygtpmtsnavrmeave
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nbqB (B:)
    amgsvtvhssepevripennpvklscaysgfssprvewkfdqgdttrlvcynnkitasye
    drvtflptgitfksvtredtgtytcmvseeggnsygevkvklivlvppskptvnipssat
    ignravltcseqdgsppseytwfkdgivmptnpkstrafsnssyvlnpttgelvfdplsa
    sdtgeyscearngygtpmtsnavrmeave
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nbqB (B:)
    mgsvtvhssepevripennpvklscaysgfssprvewkfdqgdttrlvcynnkitasyed
    rvtflptgitfksvtredtgtytcmvseeggnsygevkvklivlvppskptvnipssati
    gnravltcseqdgsppseytwfkdgivmptnpkstrafsnssyvlnpttgelvfdplsas
    dtgeyscearngygtpmtsnavrmeave