PDB entry 1nbp

View 1nbp on RCSB PDB site
Description: Crystal Structure Of Human Interleukin-2 Y31C Covalently Modified At C31 With 3-Mercapto-1-(1,3,4,9-tetrahydro-B-carbolin-2-yl)-propan-1-one
Class: cytokine
Keywords: cytokine, four-helix bundle, small molecule complex
Deposited on 2002-12-03, released 2002-12-18
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.23
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-2
    Species: HOMO SAPIENS
    Gene: IL2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60568 (Start-132)
      • engineered (30)
    Domains in SCOP 1.73: d1nbpa_
  • Heterogens: SO4, MHC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1nbpA (A:)
aptssstkktqlqlehllldlqmilnginncknpkltrmltfkfympkkatelkhlqcle
eelkpleevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnr
witfcqsiistlt

    Sequence, based on observed residues (ATOM records): (download) 
    >1nbpA (A:)
stkktqlqlehllldlqmilnginncknpkltrmltfkfympkkatelkhlqcleeelkp
leevlnlaqfhlrprdlisninvivlelkgfmceyadetativeflnrwitfcqsiistl
t