PDB entry 1nbo

View 1nbo on RCSB PDB site
Description: The dual coenzyme specificity of photosynthetic glyceraldehyde-3-phosphate dehydrogenase interpreted by the crystal structure of A4 isoform complexed with NAD
Deposited on 2002-12-03, released 2003-05-13
The last revision prior to the SCOP 1.65 freeze date was dated 2003-05-13, with a file datestamp of 2003-05-13.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.203
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nboA (A:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nboB (B:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nboB (B:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwq
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nboO (O:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqa