PDB entry 1nbe

View 1nbe on RCSB PDB site
Description: aspartate transcarbamoylase regulatory chain mutant (t82a)
Class: transferase
Keywords: atcase, allostery, pyrimidine biosynthesis, transferase
Deposited on 1998-04-25, released 1998-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.177
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate transcarbamoylase
    Species: Escherichia coli [TaxId:562]
    Gene: PURBI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A786 (0-309)
      • conflict (59)
      • conflict (146)
      • conflict (148)
      • conflict (195)
    Domains in SCOPe 2.06: d1nbea1, d1nbea2
  • Chain 'B':
    Compound: aspartate transcarbamoylase
    Species: Escherichia coli [TaxId:562]
    Gene: PURBI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7F3 (1-152)
      • engineered (81)
    Domains in SCOPe 2.06: d1nbeb1, d1nbeb2
  • Chain 'C':
    Compound: aspartate transcarbamoylase
    Species: Escherichia coli [TaxId:562]
    Gene: PURBI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A786 (0-309)
      • conflict (59)
      • conflict (146)
      • conflict (148)
      • conflict (195)
    Domains in SCOPe 2.06: d1nbec1, d1nbec2
  • Chain 'D':
    Compound: aspartate transcarbamoylase
    Species: Escherichia coli [TaxId:562]
    Gene: PURBI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7F3 (1-152)
      • engineered (81)
    Domains in SCOPe 2.06: d1nbed1, d1nbed2
  • Heterogens: ZN, MLT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nbeA (A:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfq
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqqtegrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampeyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nbeB (B:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqaavnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nbeC (C:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfq
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqqtegrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampeyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nbeD (D:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqaavnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan