PDB entry 1nbc

View 1nbc on RCSB PDB site
Description: bacterial type 3a cellulose-binding domain
Class: cellulose degradation
Keywords: cellulose degradation, cellulose-binding domain, cellulosome, scafoldin
Deposited on 1996-09-10, released 1997-09-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.193
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulosomal scaffolding protein a
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: CIPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1nbca_
  • Chain 'B':
    Compound: cellulosomal scaffolding protein a
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: CIPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1nbcb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nbcA (A:)
    nlkvefynsnpsdttnsinpqfkvtntgssaidlskltlryyytvdgqkdqtfwcdhaai
    igsngsyngitsnvkgtfvkmssstnnadtyleisftggtlepgahvqiqgrfakndwsn
    ytqsndysfksasqfvewdqvtaylngvlvwgkep
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nbcB (B:)
    nlkvefynsnpsdttnsinpqfkvtntgssaidlskltlryyytvdgqkdqtfwcdhaai
    igsngsyngitsnvkgtfvkmssstnnadtyleisftggtlepgahvqiqgrfakndwsn
    ytqsndysfksasqfvewdqvtaylngvlvwgkep