PDB entry 1nay
View 1nay on RCSB PDB site
Description: GPP-Foldon:X-ray structure
Class: structural protein
Keywords: collagen assembly, STRUCTURAL PROTEIN
Deposited on
2002-11-29, released
2003-03-25
The last revision prior to the SCOPe 2.05 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.234
AEROSPACI score: 0.26
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: collagen-like peptide
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1naya_ - Chain 'B':
Compound: collagen-like peptide
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1nayb_ - Chain 'C':
Compound: collagen-like peptide
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1nayc_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1nayA (A:)
gppgppgppgppgppgppgppgppgppgsgyipeaprdgqayvrkdgewvllstfl
- Chain 'B':
Sequence, based on SEQRES records: (download)
>1nayB (B:)
gppgppgppgppgppgppgppgppgppgsgyipeaprdgqayvrkdgewvllstfl
Sequence, based on observed residues (ATOM records): (download)
>1nayB (B:)
ppgppgppgppgppgppgppgppgppgsgyipeaprdgqayvrkdgewvllstfl
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1nayC (C:)
gppgppgppgppgppgppgppgppgppgsgyipeaprdgqayvrkdgewvllstfl