PDB entry 1nay

View 1nay on RCSB PDB site
Description: GPP-Foldon:X-ray structure
Class: structural protein
Keywords: collagen assembly, STRUCTURAL PROTEIN
Deposited on 2002-11-29, released 2003-03-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.234
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: collagen-like peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1NAY
    Domains in SCOPe 2.01: d1naya_
  • Chain 'B':
    Compound: collagen-like peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1NAY
    Domains in SCOPe 2.01: d1nayb_
  • Chain 'C':
    Compound: collagen-like peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1NAY (0-55)
    Domains in SCOPe 2.01: d1nayc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nayA (A:)
    gppgppgppgppgppgppgppgppgppgsgyipeaprdgqayvrkdgewvllstfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nayB (B:)
    gppgppgppgppgppgppgppgppgppgsgyipeaprdgqayvrkdgewvllstfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nayB (B:)
    ppgppgppgppgppgppgppgppgppgsgyipeaprdgqayvrkdgewvllstfl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nayC (C:)
    gppgppgppgppgppgppgppgppgppgsgyipeaprdgqayvrkdgewvllstfl