PDB entry 1nay

View 1nay on RCSB PDB site
Description: gpp-foldon:x-ray structure
Deposited on 2002-11-29, released 2003-03-25
The last revision prior to the SCOP 1.65 freeze date was dated 2003-03-25, with a file datestamp of 2003-03-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.234
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1naya_
  • Chain 'B':
    Domains in SCOP 1.65: d1nayb_
  • Chain 'C':
    Domains in SCOP 1.65: d1nayc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1nayA (A:)
gppgppgppgppgppgppgppgppgppgsgyipeaprdgqayvrkdgewvllstfl

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1nayB (B:)
gppgppgppgppgppgppgppgppgppgsgyipeaprdgqayvrkdgewvllstfl

    Sequence, based on observed residues (ATOM records): (download) 
    >1nayB (B:)
ppgppgppgppgppgppgppgppgppgsgyipeaprdgqayvrkdgewvllstfl

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1nayC (C:)
gppgppgppgppgppgppgppgppgppgsgyipeaprdgqayvrkdgewvllstfl