PDB entry 1naw

View 1naw on RCSB PDB site
Description: enolpyruvyl transferase
Class: transferase
Keywords: peptidoglycan biosynthesis, hinge, domain movement, sequence motif, folding, transferase
Deposited on 1996-07-23, released 1997-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-n-acetylglucosamine 1-carboxyvinyl-transferase
    Species: Enterobacter cloacae [TaxId:550]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nawa_
  • Chain 'B':
    Compound: udp-n-acetylglucosamine 1-carboxyvinyl-transferase
    Species: Enterobacter cloacae [TaxId:550]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nawb_
  • Heterogens: HAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nawA (A:)
    mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
    gtkverngsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggcaigar
    pvdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtt
    iienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflv
    aaaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphp
    afptdmqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekl
    sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nawB (B:)
    mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
    gtkverngsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggcaigar
    pvdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtt
    iienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflv
    aaaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphp
    afptdmqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekl
    sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge