PDB entry 1naw

View 1naw on RCSB PDB site
Description: enolpyruvyl transferase
Deposited on 1996-07-23, released 1997-07-23
The last revision prior to the SCOP 1.55 freeze date was dated 1999-03-11, with a file datestamp of 1999-03-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1nawa_
  • Chain 'B':
    Domains in SCOP 1.55: d1nawb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nawA (A:)
    mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
    gtkverngsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggcaigar
    pvdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtt
    iienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflv
    aaaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphp
    afptdmqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekl
    sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nawB (B:)
    mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
    gtkverngsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggcaigar
    pvdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtt
    iienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflv
    aaaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphp
    afptdmqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekl
    sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge