PDB entry 1nat

View 1nat on RCSB PDB site
Description: crystal structure of spoof from bacillus subtilis
Deposited on 1997-09-09, released 1998-10-14
The last revision prior to the SCOP 1.71 freeze date was dated 1998-10-14, with a file datestamp of 1998-10-14.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.181
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1nat__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1nat_ (-)
    mmnekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
    dgieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
    lksn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nat_ (-)
    nekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
    ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl