PDB entry 1nas

View 1nas on RCSB PDB site
Description: sepiapterin reductase complexed with n-acetyl serotonin
Deposited on 1998-03-26, released 1999-03-30
The last revision prior to the SCOP 1.55 freeze date was dated 1999-03-30, with a file datestamp of 1999-03-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.166
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1nas__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nas_ (-)
    adglgcavcvltgasrgfgralapqlarllspgsvmlvsarsesmlrqlkeelgaqqpdl
    kvvlaaadlgteagvqrllsavrelprpeglqrlllinnaatlgdvskgflnvndlaevn
    nywalnltsmlcltsgtlnafqdspglsktvvnisslcalqpykgwglycagkaardmly
    qvlaaeepsvrvlsyapgpldndmqqlaretskdpelrsklqklksdgalvdcgtsaqkl
    lgllqkdtfqsgahvdfyd