PDB entry 1nan

View 1nan on RCSB PDB site
Description: mch class I h-2kb molecule complexed with pbm1 peptide
Class: immune system
Keywords: class I MHC, H-2Kb, alloreactivity, crossreactivity, IMMUNE SYSTEM
Deposited on 2002-11-28, released 2003-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.229
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: h-2 class I histocompatibility antigen, k-b alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-K
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nanh1, d1nanh2
  • Chain 'I':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nani_
  • Chain 'L':
    Compound: h-2 class I histocompatibility antigen, k-b alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-K
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nanl1, d1nanl2
  • Chain 'M':
    Compound: pBM1 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB NP_080164 (0-7)
  • Chain 'P':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nanp_
  • Chain 'Q':
    Compound: pBM1 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB NP_080164 (0-7)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nanH (H:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrweppp
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nanI (I:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nanL (L:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrweppp
    

  • Chain 'M':
    No sequence available.

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nanP (P:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'Q':
    No sequence available.