PDB entry 1nam

View 1nam on RCSB PDB site
Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex
Deposited on 2002-11-28, released 2003-03-11
The last revision prior to the SCOP 1.71 freeze date was dated 2003-03-11, with a file datestamp of 2003-03-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.237
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1namA (A:)
    qkvtqtqtsisvmekttvtmdcvyetqdssyflfwykqtasgeivflirqdsykkenatv
    ghyslnfqkpkssigliitatqiedsavyfcamrgdyggsgnklifgtgtllsvkp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1namB (B:)
    vtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
    lpgadylatrvtdtelrlqvanmsqgrtlyctcsadrvgntlyfgegsrlivv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1namH (H:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrwe
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1namL (L:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm