PDB entry 1nak

View 1nak on RCSB PDB site
Description: igg1 fab fragment (83.1) complex with 16-residue peptide (residues 304-321 of hiv-1 gp120 (mn isolate))
Class: immune system
Keywords: immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2002-11-27, released 2003-11-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-03, with a file datestamp of 2014-08-29.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: 0.288
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab 83.1 - heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1NAK (0-213)
    Domains in SCOPe 2.06: d1nakh1, d1nakh2
  • Chain 'I':
    Compound: Fab 83.1 - heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1NAK (0-213)
    Domains in SCOPe 2.06: d1naki1, d1naki2
  • Chain 'L':
    Compound: Fab 83.1 - light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1NAK (0-End)
    Domains in SCOPe 2.06: d1nakl1, d1nakl2
  • Chain 'M':
    Compound: Fab 83.1 - light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1NAK (0-End)
    Domains in SCOPe 2.06: d1nakm1, d1nakm2
  • Chain 'P':
    Compound: Peptide MP1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1NAK
  • Chain 'Q':
    Compound: Peptide MP1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1NAK
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nakH (H:)
    evqlqesgpslvkpsqtlsltcsvtgvsitsgywnwirkfpgnkfeymgyisksgsayyn
    pslksrisftrdtsknqfylklnsvttedtatyycaiddfdiwgagttvtvssakttpps
    vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpssprpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nakI (I:)
    evqlqesgpslvkpsqtlsltcsvtgvsitsgywnwirkfpgnkfeymgyisksgsayyn
    pslksrisftrdtsknqfylklnsvttedtatyycaiddfdiwgagttvtvssakttpps
    vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpssprpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1nakL (L:)
    dvvmtqspvslpvslgdqasiscrssqslghssgntylhwflqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftfkisrveaedlgvyfcfqtthdpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nakL (L:)
    dvvmtqspvslpvslgdqasiscrssqslghssgntylhwflqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftfkisrveaedlgvyfcfqtthdpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1nakM (M:)
    dvvmtqspvslpvslgdqasiscrssqslghssgntylhwflqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftfkisrveaedlgvyfcfqtthdpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nakM (M:)
    dvvmtqspvslpvslgdqasiscrssqslghssgntylhwflqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftfkisrveaedlgvyfcfqtthdpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.