PDB entry 1nak

View 1nak on RCSB PDB site
Description: igg1 fab fragment (83.1) complex with 16-residue peptide (residues 304-321 of hiv-1 gp120 (mn isolate))
Deposited on 2002-11-27, released 2003-11-18
The last revision prior to the SCOP 1.69 freeze date was dated 2003-11-18, with a file datestamp of 2003-11-18.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: 0.288
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nakH (H:)
    evqlqesgpslvkpsqtlsltcsvtgvsitsgywnwirkfpgnkfeymgyisksgsayyn
    pslksrisftrdtsknqfylklnsvttedtatyycaiddfdiwgagttvtvssakttpps
    vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpssprpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nakI (I:)
    evqlqesgpslvkpsqtlsltcsvtgvsitsgywnwirkfpgnkfeymgyisksgsayyn
    pslksrisftrdtsknqfylklnsvttedtatyycaiddfdiwgagttvtvssakttpps
    vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpssprpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1nakL (L:)
    dvvmtqspvslpvslgdqasiscrssqslghssgntylhwflqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftfkisrveaedlgvyfcfqtthdpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nakL (L:)
    dvvmtqspvslpvslgdqasiscrssqslghssgntylhwflqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftfkisrveaedlgvyfcfqtthdpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1nakM (M:)
    dvvmtqspvslpvslgdqasiscrssqslghssgntylhwflqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftfkisrveaedlgvyfcfqtthdpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nakM (M:)
    dvvmtqspvslpvslgdqasiscrssqslghssgntylhwflqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftfkisrveaedlgvyfcfqtthdpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn