PDB entry 1na7

View 1na7 on RCSB PDB site
Description: Crystal structure of the catalytic subunit of human protein kinase CK2
Class: transferase
Keywords: CK2, protein kinase, microcrystals, thin-film nanotechnology, microfocus ESRF
Deposited on 2002-11-27, released 2003-08-26
The last revision prior to the SCOP 1.73 freeze date was dated 2003-12-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.209
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: casein kinase II, alpha chain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68400 (Start-328)
      • engineered (26)
      • engineered (75)
    Domains in SCOP 1.73: d1na7a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1na7A (A:)
    msgpvpsrarvytdvnthrpreywdyashvvewgnqddyqlvrklgrgkysevfeainit
    nnekvvvkilkpvkknkikreikilenlrggpniitladivkdpvsrtpalvfehvnntd
    fkqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglae
    fyhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnyd
    qlvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdf
    ldkllrydhqsrltareamehpyfytvvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1na7A (A:)
    pvpsrarvytdvnthrpreywdyashvvewgnqddyqlvrklgrgkysevfeainitnne
    kvvvkilkpvkknkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdfkq
    lyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefyh
    pgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydqlv
    riakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfldk
    llrydhqsrltareamehpyfytvvk