PDB entry 1na5

View 1na5 on RCSB PDB site
Description: integrin alpha m I domain
Class: cell adhesion
Keywords: Rossmann fold, CELL ADHESION
Deposited on 2002-11-26, released 2003-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.209
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin alpha-M
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGAM OR CR3A OR CD11B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11215 (Start-191)
      • cloning artifact (192-196)
    Domains in SCOPe 2.07: d1na5a1, d1na5a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1na5A (A:)
    cpqedsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfk
    efqnnpnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfg
    dplgyedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealkt
    iqnqlrekifaigspgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1na5A (A:)
    qedsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkef
    qnnpnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdp
    lgyedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiq
    nqlrekifaigspgi