PDB entry 1n9w

View 1n9w on RCSB PDB site
Description: Crystal structure of the non-discriminating and archaeal-type aspartyl-tRNA synthetase from Thermus thermophilus
Class: biosynthetic protein
Keywords: biosynthetic protein
Deposited on 2002-11-26, released 2003-04-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.227
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartyl-tRNA synthetase 2
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1n9wa1, d1n9wa2
  • Chain 'B':
    Compound: aspartyl-tRNA synthetase 2
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1n9wb1, d1n9wb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n9wA (A:)
    mrvlvrdlkahvgqevellgflhwrrdlgriqflllrdrsgvvqvvtgglklplpesalr
    vrglvvenakapgglevqakevevlspaleptpveipkeewranpdtlleyryvtlrgek
    araplkvqaalvrgfrryldrqdfteiftpkvvragaeggsglfgvdyfekraylaqspq
    lykqimvgvfervyevapvwrmeehhtsrhlneylsldvemgfiadeedlmrleeallae
    mleealntagdeirllgatwpsfpqdiprlthaeakrilkeelgypvgqdlseeaerllg
    eyakerwgsdwlfvtryprsvrpfytypeedgttrsfdllfrgleitsggqrihryeell
    eslkakgmdpeafhgylevfkygmpphggfaigaerltqkllglpnvryarafprdrhrl
    tp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9wA (A:)
    mrvlvrdlkahvgqevellgflhwrrdlgriqflllrdrsgvvqvvtgglklplpesalr
    vrglvvenakapgglevqakevevlspaleptpyryvtlrgekaraplkvqaalvrgfrr
    yldrqdfteiftppqlykqimvgvfervyevapveylsldvemgfiadeedlmrleeall
    aemleealntagdeirllgatwpsfpqdiprlthaeakrilkeelgypvgqdlseeaerl
    lgeyakerwgsdwlfvtryprsvrpfytypeedgttrsfdllfrgleitsggqrihryee
    lleslkakgmdpeafhgylevfkygmpphggfaigaerltqkllglpnvryarafp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n9wB (B:)
    mrvlvrdlkahvgqevellgflhwrrdlgriqflllrdrsgvvqvvtgglklplpesalr
    vrglvvenakapgglevqakevevlspaleptpveipkeewranpdtlleyryvtlrgek
    araplkvqaalvrgfrryldrqdfteiftpkvvragaeggsglfgvdyfekraylaqspq
    lykqimvgvfervyevapvwrmeehhtsrhlneylsldvemgfiadeedlmrleeallae
    mleealntagdeirllgatwpsfpqdiprlthaeakrilkeelgypvgqdlseeaerllg
    eyakerwgsdwlfvtryprsvrpfytypeedgttrsfdllfrgleitsggqrihryeell
    eslkakgmdpeafhgylevfkygmpphggfaigaerltqkllglpnvryarafprdrhrl
    tp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9wB (B:)
    mrvlvrdlkahvgqevellgflhwrrdlgriqflllrdrsgvvqvvtgglklplpesalr
    vrglvvenakapgglevqakevevlspaleptpveipyryvtlrgekaraplkvqaalvr
    gfrryldrqdfteiftpqlykqimvgvfervyevapveylsldvemgfiadeedlmrlee
    allaemleealntagdeirllgatwpsfpqdiprlthaeakrilkeelgypvgqdlseea
    erllgeyakerwgsdwlfvtryprsvrpfytypeedgttrsfdllfrgleitsggqrihr
    yeelleslkakgmdpeafhgylevfkygmpphggfaigaerltqkllglpnvryarafp