PDB entry 1n9p

View 1n9p on RCSB PDB site
Description: Crystal Structure of the Cytoplasmic Domain of G-protein Activated Inward Rectifier Potassium Channel 1
Class: metal transport
Keywords: beta barrel, cytoplasmic domain, g protein, inward rectifier, potassium channel, metal transport
Deposited on 2002-11-26, released 2003-01-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.231
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: G protein-activated inward rectifier potassium channel 1
    Species: Mus musculus [TaxId:10090]
    Gene: GIRK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63250 (Start-24)
      • modified residue (30)
      • modified residue (39)
      • modified residue (47)
      • modified residue (58)
      • modified residue (123)
      • modified residue (143)
      • modified residue (199)
      • modified residue (202)
    • Uniprot P35562 (25-End)
    Domains in SCOPe 2.06: d1n9pa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n9pA (A:)
    gskkrqrfvdkngrcnvqhgnlgseraetlmfsehavismrdgkltlmfrvgnlrnshmv
    saqirckllksrqtpegeflpldqleldvgfstgadqlflvspltichvidakspfydls
    qrsmqteqfevvvilegivettgmtcqartsytedevlwghrffpvisleegffkvdysq
    fhatfevptppysvkeqeemllmsspl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9pA (A:)
    rqrfvdkngrcnvqheraetlmfsehavismrdgkltlmfrvgnlrnshmvsaqirckll
    ksrqtpegeflpldqleldvgfstgadqlflvspltichvidakspfydlsqrsmqteqf
    evvvilegivettgmtcqartsytedevlwghrffpvisleegffkvdysqfhatfevpt
    ppysvkeqeemllmssp