PDB entry 1n9l

View 1n9l on RCSB PDB site
Description: Crystal structure of the Phot-LOV1 domain from Chlamydomonas reinhardtii in the dark state.
Class: electron transport
Keywords: phototropin, flavin, Electron Transport
Deposited on 2002-11-25, released 2003-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: putative blue light receptor
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8LPE0 (0-108)
  Domains in SCOPe 2.08: d1n9la_
• Heterogens: SO4, FMN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1n9lA (A:)
  glrhtfvvadatlpdcplvyasegfyamtgygpdevlghncrflqgegtdpkevqkirda
  ikkgeacsvrllnyrkdgtpfwnlltvtpiktpdgrvskfvgvqvdvts