PDB entry 1n9k

View 1n9k on RCSB PDB site
Description: Crystal structure of the bromide adduct of AphA class B acid phosphatase/phosphotransferase from E. coli at 2.2 A resolution
Class: hydrolase
Keywords: Class B acid phosphatase, DDDD acid phosphatase, metallo-enzyme bromide MAD, HYDROLASE
Deposited on 2002-11-25, released 2004-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Class B acid phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: aphA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n9ka_
  • Chain 'B':
    Compound: Class B acid phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: aphA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n9kb_
  • Heterogens: MG, BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n9kA (A:)
    sspsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgk
    ktfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptkte
    tvsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvga
    rgirilrasnstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9kA (A:)
    splnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkktf
    spesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetvs
    ktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgargi
    rilrasnstykplpqagafgeevivnsey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n9kB (B:)
    sspsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgk
    ktfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptkte
    tvsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvga
    rgirilrasnstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9kB (B:)
    splnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkktf
    spesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetvs
    ktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgargi
    rilrasnstykplpqagafgeevivnsey