PDB entry 1n9h

View 1n9h on RCSB PDB site
Description: structure of microgravity-grown oxidized myoglobin mutant YQR (ISS6A)
Class: oxygen storage/transport
Keywords: globin fold
Deposited on 2002-11-25, released 2003-06-10
The last revision prior to the SCOP 1.75 freeze date was dated 2003-06-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.154
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon
    Gene: myoglobin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-153)
      • engineered (29)
      • engineered (64)
      • engineered (67)
    Domains in SCOP 1.75: d1n9ha_
  • Heterogens: OH, SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n9hA (A:)
    mvlsegewqlvlhvwakveadvaghgqdiyirlfkshpetlekfdrfkhlkteaemkase
    dlkkqgvrvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg