PDB entry 1n9g

View 1n9g on RCSB PDB site
Description: mitochondrial 2-enoyl thioester reductase etr1p/etr2p heterodimer from candida tropicalis
Deposited on 2002-11-25, released 2003-12-09
The last revision prior to the SCOP 1.71 freeze date was dated 2003-12-09, with a file datestamp of 2003-12-09.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.197
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n9gA (A:)
    mysvlkqsirprllathnqfrtmitaqavlytqhgepkdvlftqsfeidddnlapneviv
    ktlgspinpsdinqiqgvypskpakttgfgtaepaapcgneglfevikvgsnvssleagd
    wvipshvnfgtwrthalgndddfiklpnpaqskangkpngltinqgatisvnpltaylml
    thyvkltpgkdwfiqnggtsavgkyasqigkllnfnsisvirdrpnldevvaslkelgat
    qvitedqnnskefgptikewikqsggeaklalncvggksstgiarklnnnglmltyggms
    fqpvtiptslyifknftsagfwvtellknnkelktstlnqiiawyeegkltdaksietly
    dgtkplhelyqdgvanskdgkqlity
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9gA (A:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspinpsdinqiqgvypsk
    pakttgfgtaepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnskefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n9gB (B:)
    mysvlkqsirprllathnqfrtmitaqavlytqhgepkdvlftqsfeidddnlapneviv
    ktlgspvnpsdinqiqgvypskpakttgfgttepaapcgneglfevikvgsnvssleagd
    wvipshvnfgtwrthalgndddfiklpnpaqskangkpngltinqgatisvnpltaylml
    thyvkltpgkdwfiqnggtsavgkyasqigkllnfnsisvirdrpnldevvaslkelgat
    qvitedqnnsrefgptikewikqsggeaklalncvggksstgiarklnnnglmltyggms
    fqpvtiptslyifknftsagfwvtellknnkelktstlnqiiawyeegkltdaksietly
    dgtkplhelyqdgvanskdgkqlity
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9gB (B:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvypsk
    pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnsrefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n9gC (C:)
    mysvlkqsirprllathnqfrtmitaqavlytqhgepkdvlftqsfeidddnlapneviv
    ktlgspinpsdinqiqgvypskpakttgfgtaepaapcgneglfevikvgsnvssleagd
    wvipshvnfgtwrthalgndddfiklpnpaqskangkpngltinqgatisvnpltaylml
    thyvkltpgkdwfiqnggtsavgkyasqigkllnfnsisvirdrpnldevvaslkelgat
    qvitedqnnskefgptikewikqsggeaklalncvggksstgiarklnnnglmltyggms
    fqpvtiptslyifknftsagfwvtellknnkelktstlnqiiawyeegkltdaksietly
    dgtkplhelyqdgvanskdgkqlity
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9gC (C:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspinpsdinqiqgvypsk
    pakttgfgtaepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnskefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1n9gD (D:)
    mysvlkqsirprllathnqfrtmitaqavlytqhgepkdvlftqsfeidddnlapneviv
    ktlgspvnpsdinqiqgvypskpakttgfgttepaapcgneglfevikvgsnvssleagd
    wvipshvnfgtwrthalgndddfiklpnpaqskangkpngltinqgatisvnpltaylml
    thyvkltpgkdwfiqnggtsavgkyasqigkllnfnsisvirdrpnldevvaslkelgat
    qvitedqnnsrefgptikewikqsggeaklalncvggksstgiarklnnnglmltyggms
    fqpvtiptslyifknftsagfwvtellknnkelktstlnqiiawyeegkltdaksietly
    dgtkplhelyqdgvanskdgkqlity
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9gD (D:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvypsk
    pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnsrefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1n9gE (E:)
    mysvlkqsirprllathnqfrtmitaqavlytqhgepkdvlftqsfeidddnlapneviv
    ktlgspvnpsdinqiqgvypskpakttgfgttepaapcgneglfevikvgsnvssleagd
    wvipshvnfgtwrthalgndddfiklpnpaqskangkpngltinqgatisvnpltaylml
    thyvkltpgkdwfiqnggtsavgkyasqigkllnfnsisvirdrpnldevvaslkelgat
    qvitedqnnsrefgptikewikqsggeaklalncvggksstgiarklnnnglmltyggms
    fqpvtiptslyifknftsagfwvtellknnkelktstlnqiiawyeegkltdaksietly
    dgtkplhelyqdgvanskdgkqlity
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9gE (E:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvypsk
    pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnsrefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1n9gF (F:)
    mysvlkqsirprllathnqfrtmitaqavlytqhgepkdvlftqsfeidddnlapneviv
    ktlgspinpsdinqiqgvypskpakttgfgtaepaapcgneglfevikvgsnvssleagd
    wvipshvnfgtwrthalgndddfiklpnpaqskangkpngltinqgatisvnpltaylml
    thyvkltpgkdwfiqnggtsavgkyasqigkllnfnsisvirdrpnldevvaslkelgat
    qvitedqnnskefgptikewikqsggeaklalncvggksstgiarklnnnglmltyggms
    fqpvtiptslyifknftsagfwvtellknnkelktstlnqiiawyeegkltdaksietly
    dgtkplhelyqdgvanskdgkqlity
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9gF (F:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspinpsdinqiqgvypsk
    pakttgfgtaepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnskefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity