PDB entry 1n9g

View 1n9g on RCSB PDB site
Description: Mitochondrial 2-enoyl thioester reductase Etr1p/Etr2p heterodimer from Candida tropicalis
Class: hydrolase
Keywords: heterodimer, Rossmann fold, HYDROLASE
Deposited on 2002-11-25, released 2003-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2,4-dienoyl-CoA reductase
    Species: Candida tropicalis [TaxId:5482]
    Gene: ETR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n9ga1, d1n9ga2
  • Chain 'B':
    Compound: 2,4-dienoyl-CoA reductase
    Species: Candida tropicalis [TaxId:5482]
    Gene: ETR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n9gb1, d1n9gb2
  • Chain 'C':
    Compound: 2,4-dienoyl-CoA reductase
    Species: Candida tropicalis [TaxId:5482]
    Gene: ETR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n9gc1, d1n9gc2
  • Chain 'D':
    Compound: 2,4-dienoyl-CoA reductase
    Species: Candida tropicalis [TaxId:5482]
    Gene: ETR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n9gd1, d1n9gd2
  • Chain 'E':
    Compound: 2,4-dienoyl-CoA reductase
    Species: Candida tropicalis [TaxId:5482]
    Gene: ETR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n9ge1, d1n9ge2
  • Chain 'F':
    Compound: 2,4-dienoyl-CoA reductase
    Species: Candida tropicalis [TaxId:5482]
    Gene: ETR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n9gf1, d1n9gf2
  • Heterogens: SO4, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n9gA (A:)
    mysvlkqsirprllathnqfrtmitaqavlytqhgepkdvlftqsfeidddnlapneviv
    ktlgspinpsdinqiqgvypskpakttgfgtaepaapcgneglfevikvgsnvssleagd
    wvipshvnfgtwrthalgndddfiklpnpaqskangkpngltinqgatisvnpltaylml
    thyvkltpgkdwfiqnggtsavgkyasqigkllnfnsisvirdrpnldevvaslkelgat
    qvitedqnnskefgptikewikqsggeaklalncvggksstgiarklnnnglmltyggms
    fqpvtiptslyifknftsagfwvtellknnkelktstlnqiiawyeegkltdaksietly
    dgtkplhelyqdgvanskdgkqlity
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9gA (A:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspinpsdinqiqgvypsk
    pakttgfgtaepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnskefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n9gB (B:)
    mysvlkqsirprllathnqfrtmitaqavlytqhgepkdvlftqsfeidddnlapneviv
    ktlgspvnpsdinqiqgvypskpakttgfgttepaapcgneglfevikvgsnvssleagd
    wvipshvnfgtwrthalgndddfiklpnpaqskangkpngltinqgatisvnpltaylml
    thyvkltpgkdwfiqnggtsavgkyasqigkllnfnsisvirdrpnldevvaslkelgat
    qvitedqnnsrefgptikewikqsggeaklalncvggksstgiarklnnnglmltyggms
    fqpvtiptslyifknftsagfwvtellknnkelktstlnqiiawyeegkltdaksietly
    dgtkplhelyqdgvanskdgkqlity
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9gB (B:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvypsk
    pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnsrefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n9gC (C:)
    mysvlkqsirprllathnqfrtmitaqavlytqhgepkdvlftqsfeidddnlapneviv
    ktlgspinpsdinqiqgvypskpakttgfgtaepaapcgneglfevikvgsnvssleagd
    wvipshvnfgtwrthalgndddfiklpnpaqskangkpngltinqgatisvnpltaylml
    thyvkltpgkdwfiqnggtsavgkyasqigkllnfnsisvirdrpnldevvaslkelgat
    qvitedqnnskefgptikewikqsggeaklalncvggksstgiarklnnnglmltyggms
    fqpvtiptslyifknftsagfwvtellknnkelktstlnqiiawyeegkltdaksietly
    dgtkplhelyqdgvanskdgkqlity
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9gC (C:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspinpsdinqiqgvypsk
    pakttgfgtaepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnskefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1n9gD (D:)
    mysvlkqsirprllathnqfrtmitaqavlytqhgepkdvlftqsfeidddnlapneviv
    ktlgspvnpsdinqiqgvypskpakttgfgttepaapcgneglfevikvgsnvssleagd
    wvipshvnfgtwrthalgndddfiklpnpaqskangkpngltinqgatisvnpltaylml
    thyvkltpgkdwfiqnggtsavgkyasqigkllnfnsisvirdrpnldevvaslkelgat
    qvitedqnnsrefgptikewikqsggeaklalncvggksstgiarklnnnglmltyggms
    fqpvtiptslyifknftsagfwvtellknnkelktstlnqiiawyeegkltdaksietly
    dgtkplhelyqdgvanskdgkqlity
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9gD (D:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvypsk
    pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnsrefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1n9gE (E:)
    mysvlkqsirprllathnqfrtmitaqavlytqhgepkdvlftqsfeidddnlapneviv
    ktlgspvnpsdinqiqgvypskpakttgfgttepaapcgneglfevikvgsnvssleagd
    wvipshvnfgtwrthalgndddfiklpnpaqskangkpngltinqgatisvnpltaylml
    thyvkltpgkdwfiqnggtsavgkyasqigkllnfnsisvirdrpnldevvaslkelgat
    qvitedqnnsrefgptikewikqsggeaklalncvggksstgiarklnnnglmltyggms
    fqpvtiptslyifknftsagfwvtellknnkelktstlnqiiawyeegkltdaksietly
    dgtkplhelyqdgvanskdgkqlity
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9gE (E:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvypsk
    pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnsrefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1n9gF (F:)
    mysvlkqsirprllathnqfrtmitaqavlytqhgepkdvlftqsfeidddnlapneviv
    ktlgspinpsdinqiqgvypskpakttgfgtaepaapcgneglfevikvgsnvssleagd
    wvipshvnfgtwrthalgndddfiklpnpaqskangkpngltinqgatisvnpltaylml
    thyvkltpgkdwfiqnggtsavgkyasqigkllnfnsisvirdrpnldevvaslkelgat
    qvitedqnnskefgptikewikqsggeaklalncvggksstgiarklnnnglmltyggms
    fqpvtiptslyifknftsagfwvtellknnkelktstlnqiiawyeegkltdaksietly
    dgtkplhelyqdgvanskdgkqlity
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9gF (F:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspinpsdinqiqgvypsk
    pakttgfgtaepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnskefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity