PDB entry 1n9f

View 1n9f on RCSB PDB site
Description: structure of earth-grown oxidized myoglobin mutant yqr (iss6a)
Deposited on 2002-11-25, released 2003-06-10
The last revision prior to the SCOP 1.71 freeze date was dated 2003-06-10, with a file datestamp of 2003-06-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1n9fa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1n9fA (A:)
mvlsegewqlvlhvwakveadvaghgqdiyirlfkshpetlekfdrfkhlkteaemkase
dlkkqgvrvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg