PDB entry 1n9e

View 1n9e on RCSB PDB site
Description: crystal structure of pichia pastoris lysyl oxidase pplo
Deposited on 2002-11-24, released 2004-01-13
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-20, with a file datestamp of 2004-01-20.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.16
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n9eA (A:)
    mrltnllslttlvalavavpdfyqkreavsskeaallrrdasaecvsnenveieapktni
    wtslakeevqevldllhstynitevtkadffsnyvlwietlkpnktealtyldedgdlpp
    rnartvvyfgegeegyfeelkvgplpvsdettieplsfyntngksklpfevghldriksa
    akssflnknlnttimrdvlegligvpyedmgchsaapqlhdpatgatvdygtcnintend
    aenlvptgfffkfdmtgrdvsqwkmleyiynnkvytsaeelyeamqkddfvtlpkidvdn
    ldwtviqrndsapirhlddrksprlvepegrrwaydgeeeyfswmdwgfytswsrdtgis
    fyditfkgerivyelslqeliaeygsddpfnqhtfysdisygvgnrfslvpgydcpatag
    yfttdtfeydefynrtlsycvfenqedysllrhtgasysaitqnptlnvrfistignady
    nflykffldgtlevsvraagyiqagywnpetsapyglkihdvlsgsfhdhvlnykvdldv
    ggtknraskyvmkdvdveypwapgtvyntkqiarevlekedfnginwpengqgilliesa
    eetnsfgnpraynimpggggvhrivknsrsgpetqnwarsnlfltkhkdeelrsstalnt
    nalydppvnfnaflddesldgedivawvnlglhhlpnsndlpntifstahasfmltpfny
    fdsensrdttqqvfytyddeteesnwefygndwsscglevpepnfedytygrgtrinkkm
    tnsdevy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9eA (A:)
    asaecvsnenveieapktniwtslakeevqevldllhstynitevtkadffsnyvlwiet
    lkpnktealtyldedgdlpprnartvvyfgegeegyfeelkvgplpvsdettieplsfyn
    tngksklpfevghldriksaakssflnknlnttimrdvlegligvpyedmgchsaapqlh
    dpatgatvdygtcnintendaenlvptgfffkfdmtgrdvsqwkmleyiynnkvytsaee
    lyeamqkddfvtlpkidvdnldwtviqrndsapirhlddrksprlvepegrrwaydgeee
    yfswmdwgfytswsrdtgisfyditfkgerivyelslqeliaeygsddpfnqhtfysdis
    ygvgnrfslvpgydcpatagyfttdtfeydefynrtlsycvfenqedysllrhtgasysa
    itqnptlnvrfistignadynflykffldgtlevsvraagyiqagywnpetsapyglkih
    dvlsgsfhdhvlnykvdldvggtknraskyvmkdvdveypwapgtvyntkqiarevleke
    dfnginwpengqgilliesaeetnsfgnpraynimpggggvhrivknsrsgpetqnwars
    nlfltkhkdeelrsstalntnalydppvnfnaflddesldgedivawvnlglhhlpnsnd
    lpntifstahasfmltpfnyfdsensrdttqqvfytyddeteesnwefygndwsscglev
    pepnfedytygrgtr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n9eB (B:)
    mrltnllslttlvalavavpdfyqkreavsskeaallrrdasaecvsnenveieapktni
    wtslakeevqevldllhstynitevtkadffsnyvlwietlkpnktealtyldedgdlpp
    rnartvvyfgegeegyfeelkvgplpvsdettieplsfyntngksklpfevghldriksa
    akssflnknlnttimrdvlegligvpyedmgchsaapqlhdpatgatvdygtcnintend
    aenlvptgfffkfdmtgrdvsqwkmleyiynnkvytsaeelyeamqkddfvtlpkidvdn
    ldwtviqrndsapirhlddrksprlvepegrrwaydgeeeyfswmdwgfytswsrdtgis
    fyditfkgerivyelslqeliaeygsddpfnqhtfysdisygvgnrfslvpgydcpatag
    yfttdtfeydefynrtlsycvfenqedysllrhtgasysaitqnptlnvrfistignady
    nflykffldgtlevsvraagyiqagywnpetsapyglkihdvlsgsfhdhvlnykvdldv
    ggtknraskyvmkdvdveypwapgtvyntkqiarevlekedfnginwpengqgilliesa
    eetnsfgnpraynimpggggvhrivknsrsgpetqnwarsnlfltkhkdeelrsstalnt
    nalydppvnfnaflddesldgedivawvnlglhhlpnsndlpntifstahasfmltpfny
    fdsensrdttqqvfytyddeteesnwefygndwsscglevpepnfedytygrgtrinkkm
    tnsdevy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9eB (B:)
    asaecvsnenveieapktniwtslakeevqevldllhstynitevtkadffsnyvlwiet
    lkpnktealtyldedgdlpprnartvvyfgegeegyfeelkvgplpvsdettieplsfyn
    tngksklpfevghldriksaakssflnknlnttimrdvlegligvpyedmgchsaapqlh
    dpatgatvdygtcnintendaenlvptgfffkfdmtgrdvsqwkmleyiynnkvytsaee
    lyeamqkddfvtlpkidvdnldwtviqrndsapirhlddrksprlvepegrrwaydgeee
    yfswmdwgfytswsrdtgisfyditfkgerivyelslqeliaeygsddpfnqhtfysdis
    ygvgnrfslvpgydcpatagyfttdtfeydefynrtlsycvfenqedysllrhtgasysa
    itqnptlnvrfistignadynflykffldgtlevsvraagyiqagywnpetsapyglkih
    dvlsgsfhdhvlnykvdldvggtknraskyvmkdvdveypwapgtvyntkqiarevleke
    dfnginwpengqgilliesaeetnsfgnpraynimpggggvhrivknsrsgpetqnwars
    nlfltkhkdeelrsstalntnalydppvnfnaflddesldgedivawvnlglhhlpnsnd
    lpntifstahasfmltpfnyfdsensrdttqqvfytyddeteesnwefygndwsscglev
    pepnfedytygrgtr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n9eC (C:)
    mrltnllslttlvalavavpdfyqkreavsskeaallrrdasaecvsnenveieapktni
    wtslakeevqevldllhstynitevtkadffsnyvlwietlkpnktealtyldedgdlpp
    rnartvvyfgegeegyfeelkvgplpvsdettieplsfyntngksklpfevghldriksa
    akssflnknlnttimrdvlegligvpyedmgchsaapqlhdpatgatvdygtcnintend
    aenlvptgfffkfdmtgrdvsqwkmleyiynnkvytsaeelyeamqkddfvtlpkidvdn
    ldwtviqrndsapirhlddrksprlvepegrrwaydgeeeyfswmdwgfytswsrdtgis
    fyditfkgerivyelslqeliaeygsddpfnqhtfysdisygvgnrfslvpgydcpatag
    yfttdtfeydefynrtlsycvfenqedysllrhtgasysaitqnptlnvrfistignady
    nflykffldgtlevsvraagyiqagywnpetsapyglkihdvlsgsfhdhvlnykvdldv
    ggtknraskyvmkdvdveypwapgtvyntkqiarevlekedfnginwpengqgilliesa
    eetnsfgnpraynimpggggvhrivknsrsgpetqnwarsnlfltkhkdeelrsstalnt
    nalydppvnfnaflddesldgedivawvnlglhhlpnsndlpntifstahasfmltpfny
    fdsensrdttqqvfytyddeteesnwefygndwsscglevpepnfedytygrgtrinkkm
    tnsdevy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9eC (C:)
    asaecvsnenveieapktniwtslakeevqevldllhstynitevtkadffsnyvlwiet
    lkpnktealtyldedgdlpprnartvvyfgegeegyfeelkvgplpvsdettieplsfyn
    tngksklpfevghldriksaakssflnknlnttimrdvlegligvpyedmgchsaapqlh
    dpatgatvdygtcnintendaenlvptgfffkfdmtgrdvsqwkmleyiynnkvytsaee
    lyeamqkddfvtlpkidvdnldwtviqrndsapirhlddrksprlvepegrrwaydgeee
    yfswmdwgfytswsrdtgisfyditfkgerivyelslqeliaeygsddpfnqhtfysdis
    ygvgnrfslvpgydcpatagyfttdtfeydefynrtlsycvfenqedysllrhtgasysa
    itqnptlnvrfistignadynflykffldgtlevsvraagyiqagywnpetsapyglkih
    dvlsgsfhdhvlnykvdldvggtknraskyvmkdvdveypwapgtvyntkqiarevleke
    dfnginwpengqgilliesaeetnsfgnpraynimpggggvhrivknsrsgpetqnwars
    nlfltkhkdeelrsstalntnalydppvnfnaflddesldgedivawvnlglhhlpnsnd
    lpntifstahasfmltpfnyfdsensrdttqqvfytyddeteesnwefygndwsscglev
    pepnfedytygrgtr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1n9eD (D:)
    mrltnllslttlvalavavpdfyqkreavsskeaallrrdasaecvsnenveieapktni
    wtslakeevqevldllhstynitevtkadffsnyvlwietlkpnktealtyldedgdlpp
    rnartvvyfgegeegyfeelkvgplpvsdettieplsfyntngksklpfevghldriksa
    akssflnknlnttimrdvlegligvpyedmgchsaapqlhdpatgatvdygtcnintend
    aenlvptgfffkfdmtgrdvsqwkmleyiynnkvytsaeelyeamqkddfvtlpkidvdn
    ldwtviqrndsapirhlddrksprlvepegrrwaydgeeeyfswmdwgfytswsrdtgis
    fyditfkgerivyelslqeliaeygsddpfnqhtfysdisygvgnrfslvpgydcpatag
    yfttdtfeydefynrtlsycvfenqedysllrhtgasysaitqnptlnvrfistignady
    nflykffldgtlevsvraagyiqagywnpetsapyglkihdvlsgsfhdhvlnykvdldv
    ggtknraskyvmkdvdveypwapgtvyntkqiarevlekedfnginwpengqgilliesa
    eetnsfgnpraynimpggggvhrivknsrsgpetqnwarsnlfltkhkdeelrsstalnt
    nalydppvnfnaflddesldgedivawvnlglhhlpnsndlpntifstahasfmltpfny
    fdsensrdttqqvfytyddeteesnwefygndwsscglevpepnfedytygrgtrinkkm
    tnsdevy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9eD (D:)
    asaecvsnenveieapktniwtslakeevqevldllhstynitevtkadffsnyvlwiet
    lkpnktealtyldedgdlpprnartvvyfgegeegyfeelkvgplpvsdettieplsfyn
    tngksklpfevghldriksaakssflnknlnttimrdvlegligvpyedmgchsaapqlh
    dpatgatvdygtcnintendaenlvptgfffkfdmtgrdvsqwkmleyiynnkvytsaee
    lyeamqkddfvtlpkidvdnldwtviqrndsapirhlddrksprlvepegrrwaydgeee
    yfswmdwgfytswsrdtgisfyditfkgerivyelslqeliaeygsddpfnqhtfysdis
    ygvgnrfslvpgydcpatagyfttdtfeydefynrtlsycvfenqedysllrhtgasysa
    itqnptlnvrfistignadynflykffldgtlevsvraagyiqagywnpetsapyglkih
    dvlsgsfhdhvlnykvdldvggtknraskyvmkdvdveypwapgtvyntkqiarevleke
    dfnginwpengqgilliesaeetnsfgnpraynimpggggvhrivknsrsgpetqnwars
    nlfltkhkdeelrsstalntnalydppvnfnaflddesldgedivawvnlglhhlpnsnd
    lpntifstahasfmltpfnyfdsensrdttqqvfytyddeteesnwefygndwsscglev
    pepnfedytygrgtr