PDB entry 1n9d

View 1n9d on RCSB PDB site
Description: solution structure of human prolactin
Class: hormone/growth factor
Keywords: four alpha-helical bundle, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2002-11-23, released 2003-05-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prolactin
    Species: Homo sapiens [TaxId:9606]
    Gene: PRL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1n9da_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1n9dA (A:)
lpicpggaarcqvtlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainscht
sslatpedkeqaqqmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveie
eqtkrllegmelivsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdsh
kidnylkllkcriihnnnc