PDB entry 1n9a

View 1n9a on RCSB PDB site
Description: Farnesyltransferase complex with tetrahydropyridine inhibitors
Class: transferase
Keywords: Farnesyltransferase, tetrahydropyridine, Prenyltransferase
Deposited on 2002-11-22, released 2003-01-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.329
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein farnesyltransferase alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04631 (0-End)
      • conflict (101)
    Domains in SCOPe 2.07: d1n9aa_
  • Chain 'B':
    Compound: Protein farnesyltransferase beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n9ab_
  • Heterogens: ZN, HFP, FTI

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n9aA (A:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyitaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9aA (A:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyitaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n9aB (B:)
    plyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhy
    lkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfg
    ggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdv
    rsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvi
    lkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdp
    alsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgam
    lhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n9aB (B:)
    lyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhyl
    krglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfgg
    gpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdvr
    saycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvil
    kkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdpa
    lsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgaml
    hdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf