PDB entry 1n99

View 1n99 on RCSB PDB site
Description: crystal structure of the pdz tandem of human syntenin
Class: signaling protein
Keywords: PDZ domain
Deposited on 2002-11-22, released 2003-04-15
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.186
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Syntenin 1
    Species: HOMO SAPIENS
    Gene: SDCBP OR MDA9 OR SYCL
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00560 (5-165)
      • cloning artifact (4)
      • modified residue (80)
      • modified residue (93)
      • modified residue (162)
    Domains in SCOP 1.75: d1n99a1, d1n99a2
  • Chain 'B':
    Compound: Syntenin 1
    Species: HOMO SAPIENS
    Gene: SDCBP OR MDA9 OR SYCL
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00560 (5-End)
      • mod. residue/cloning artifact (2)
      • cloning artifact (3-4)
      • modified residue (80)
      • modified residue (93)
      • modified residue (162)
    Domains in SCOP 1.75: d1n99b1, d1n99b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n99A (A:)
    gamdprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingenca
    gwssdkahkvlkqafgekitmtirdrpfertitmhkdstghvgfifkngkitsivkdssa
    arnglltehniceingqnviglkdsqiadilstsgtvvtitimpaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n99A (A:)
    previlckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingencagwss
    dkahkvlkqafgekitmtirdrpfertitmhkdstghvgfifkngkitsivkdssaarng
    lltehniceingqnviglkdsqiadilstsgtvvtitimpaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n99B (B:)
    gamdprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingenca
    gwssdkahkvlkqafgekitmtirdrpfertitmhkdstghvgfifkngkitsivkdssa
    arnglltehniceingqnviglkdsqiadilstsgtvvtitimpaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n99B (B:)
    mdprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingencagw
    ssdkahkvlkqafgekitmtirdrpfertitmhkdstghvgfifkngkitsivkdssaar
    nglltehniceingqnviglkdsqiadilstsgtvvtitimpa