PDB entry 1n98

View 1n98 on RCSB PDB site
Description: Crystal structure of ALL-D Monellin at 1.8 A resolution
Deposited on 2002-11-22, released 2002-12-25
The last revision prior to the SCOP 1.67 freeze date was dated 2002-12-25, with a file datestamp of 2002-12-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.175
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1n98.1
  • Chain 'B':
    Domains in SCOP 1.67: d1n98.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1n98A (A:)
eikgyeyqlyvyasdklfradisedyktrgrkllrfngpvppp

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1n98B (B:)
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiye