PDB entry 1n92

View 1n92 on RCSB PDB site
Description: Horse Liver Alcohol Dehydrogenase Complexed with NAD+ and 4-Iodopyrazole
Class: oxidoreductase
Keywords: dehydrogenase, alcohol, nicotinamide coenzyme, 4-iodopyrazole, OXIDOREDUCTASE
Deposited on 2002-11-21, released 2003-02-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.151
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase e chain
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n92a1, d1n92a2
  • Chain 'B':
    Compound: alcohol dehydrogenase e chain
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n92b1, d1n92b2
  • Heterogens: ZN, NAJ, PYZ, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n92A (A:)
    stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
    lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
    gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcgfstgy
    gsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdkfakakevgatec
    vnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgvppdsqn
    lsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfd
    llrsgesirtiltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n92B (B:)
    stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
    lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
    gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcgfstgy
    gsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdkfakakevgatec
    vnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgvppdsqn
    lsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakkfaldplithvlpfekinegfd
    llrsgesirtiltf